PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV50576.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 267aa    MW: 29874.3 Da    PI: 5.3521
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV50576.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.7e-2186146257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t+ ql+ Le lF + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  KZV50576.1  86 RQRWTPTPMQLQYLEHLFDQgNGTPSKQKIKEITTELsqhgQISETNVYNWFQNRRARSKR 146
                 89*****************99**************************************97 PP

2Wus_type_Homeobox98.84e-3286148365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++ Le+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
         KZV50576.1  86 RQRWTPTPMQLQYLEHLFDQGNGTPSKQKIKEITTELSQHGQISETNVYNWFQNRRARSKRKQ 148
                        89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1779154IPR009057Homeodomain-like
PROSITE profilePS5007114.81982147IPR001356Homeobox domain
SuperFamilySSF466893.38E-1983153IPR009057Homeodomain-like
SMARTSM003894.7E-1484151IPR001356Homeobox domain
CDDcd000861.33E-1386148No hitNo description
PfamPF000465.1E-1986146IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEWQKPPPPQ QGDDFNGGGG GMFVKVMTDE QMEDLRKQIA VYATICEQLV ELHKSLTSQN  60
DLPGVRFGNP YCDALITSGT HKITGRQRWT PTPMQLQYLE HLFDQGNGTP SKQKIKEITT  120
ELSQHGQISE TNVYNWFQNR RARSKRKQQA APTANNVDSE VEAEVESPNE KMKKPEESQP  180
PHILCARTED LCFQSSQCTS AIHTVDSHVS KSETMLSPDG SSTLGGSFGQ TSFYGSILPN  240
SRMDSLIGKM ELPGNYDPYL HQDDFMA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099896.11e-135PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM35e-84WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A068TZT51e-120A0A068TZT5_COFCA; Uncharacterized protein
STRINGSolyc02g082670.2.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.19e-68WUSCHEL related homeobox 13